PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003094.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 281aa    MW: 31935.8 Da    PI: 4.7412
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003094.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.5e-51181461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp+GfrFhPtdeel+++yLk +++g+k e+ ++i e+diyk+ePwdLp  + +k++++ew+fF++ ++ky++g+r nrat+ g+Wk
  Itr_sc003094.1_g00006.1  18 LPVGFRFHPTDEELINHYLKLNINGSKAEV-SMICEIDIYKLEPWDLPdlSVIKSHDNEWFFFCPIERKYQNGQRMNRATELGFWK 102
                              79*************************999.89**************96448899999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++lskk+ ++g+kktLv+y+gr ++g++++Wv+heyr+
  Itr_sc003094.1_g00006.1 103 ATGKDRNILSKKRVKIGMKKTLVYYEGRGSNGKRSNWVIHEYRA 146
                              ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-559160IPR003441NAC domain
PROSITE profilePS5100550.20418160IPR003441NAC domain
PfamPF023654.8E-2619145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MVPLERSTTK VLLPPSSLPV GFRFHPTDEE LINHYLKLNI NGSKAEVSMI CEIDIYKLEP  60
WDLPDLSVIK SHDNEWFFFC PIERKYQNGQ RMNRATELGF WKATGKDRNI LSKKRVKIGM  120
KKTLVYYEGR GSNGKRSNWV IHEYRATGET PFVLCRLFKK NENGESGNSN GVEPNVSSPI  180
VVKSPGEDDQ SDRINANNAE KYVDIVHDPD LEEALAYLYE PSEEHFDIFS LPQTEMEGLG  240
FSYAVTNDIQ SLSETNISDA NEFLNSFLVS PDEIPYANGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-421716214171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075874.12e-86PREDICTED: NAC domain-containing protein 45
SwissprotB5X5708e-68NAC14_ARATH; NAC domain-containing protein 14
SwissprotQ9LKG82e-68NAC91_ARATH; NAC domain-containing protein 91
TrEMBLM0ZIK55e-85M0ZIK5_SOLTU; Uncharacterized protein
TrEMBLK4C9257e-84K4C925_SOLLC; Uncharacterized protein
TrEMBLM1CKK67e-84M1CKK6_SOLTU; Uncharacterized protein
STRINGSolyc06g073050.2.12e-83(Solanum lycopersicum)
STRINGPGSC0003DMT4000695112e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.29e-69NAC 014